What's the difference between born and orn?

Born


Definition:

  • (p. p.) of Bear
  • (v. t.) Brought forth, as an animal; brought into life; introduced by birth.
  • (v. t.) Having from birth a certain character; by or from birth; by nature; innate; as, a born liar.

Example Sentences:

  • (1) Here we have asked whether protection from blood-borne antigens afforded by the blood-brain barrier is related to the lack of MHC expression.
  • (2) In this article we report the survival and morbidity rates for all live-born infants weighing 501 to 1000 gram at birth and born to residents of a defined geographic region from 1977 to 1980 (n = 255) compared with 1981 to 1984 (n = 266).
  • (3) It wasn’t an easy decision because I was born in Kingston, Jamaica,” acknowledged Aarons.
  • (4) Nulliparous women were also more likely to discontinue the condom because of pregnancy, as were non-Protestants and the Australian-born.
  • (5) All the twins were born in years 1973-1987, the total number was 2,226 boys and 2,302 girls.
  • (6) There were 101 unwanted pregnancies, and 1 child was born with intersexual genitals.
  • (7) There are no published reports of its detection in neonates born to affected mothers.
  • (8) Aryl hydrocarbon hydroxylase (AHH) inducibility, carbon monoxide in expired air (CO), serum gammaglutamyl-transferase (GGT), and total cholesterol were compared in equal-sized, age-matched samples of healthy middle-aged males born in 1921, 1934-1936, and 1946 attending the ongoing preventive medical population program in Malmö.
  • (9) There were 4 spontaneous first trimester abortions and 21 live-born neonates without major problems related to the treatment or to the maternal disease.
  • (10) The expectation of life at birth was only 30-35 years, but it was long enough to allow for children to be born and for the populations to expand.
  • (11) Whereas the tight junctions of endoneurial capillaries are known to prevent certain blood-borne substances from entering the endoneurium, it was not clear whether the permeability of the pulpal capillaries, which are distant from the nerve fibres, could affect the nerve fibre environment.
  • (12) The data of first 1000 first-born, non-malformed, mature (greater than or equal to 2500 g) offspring of participants in the Hungarian "Optimal" Family Planning Programme were evaluated.
  • (13) Scott was born in North Shields, Tyne and Wear, the youngest of the three sons of Colonel Francis Percy Scott, who served in the Royal Engineers, and his wife, Elizabeth.
  • (14) After all, he reminds us, the Smiths can take no credit for the place, having only been born and brought up there, not responsible for its size and stature.
  • (15) It is the most commonly reported vector-borne disease in the United States, where the incidence is highest in the eastern and midwestern states.
  • (16) < 37 weeks) small for gestational age (SGA) born from 1980 to 1987 in Pavia and admitted to the Neonatal Intensive Care Unit of S. Matteo Hospital (Pavia).
  • (17) Polypeptides of egg-borne Sendai virus (egg Sendai), which is biologically active on the basis of criteria of the infectivity for L cells and of hemolytic and cell fusion activities, were compared by polyacrylamide gel electrophoresis with those of L cell-borne (L Sendai) and HeLa cell-borne Sendai (HeLa Sendai) viruses, which are judged biologically inactive by the above criteria.
  • (18) The genetic management of the African green monkey breeding colony was discussed in relation to the difference in distribution of phenotypes of M and ABO blood groups between the parental (wild-originated) and the first filial (colony-born) populations.
  • (19) What we see from those opposite and we see in this chamber every day is the 'born to rule mentality' of those opposite.
  • (20) This is welcome news but it needs to be borne in mind that the manufacturing sector is still far from racing ahead and serious doubts remain about the strength of demand for manufactured goods over the medium term, particularly once stimulative measures start being withdrawn.

Orn


Definition:

  • (v. t.) To ornament; to adorn.

Example Sentences:

  • (1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
  • (2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
  • (3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
  • (4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
  • (5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
  • (6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
  • (7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
  • (8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
  • (9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
  • (10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
  • (11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
  • (12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
  • (13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
  • (14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
  • (15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
  • (16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
  • (17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
  • (18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
  • (19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
  • (20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).

Words possibly related to "born"

Words possibly related to "orn"