What's the difference between chin and chinchilla?
Chin
Definition:
(n.) The lower extremity of the face below the mouth; the point of the under jaw.
(n.) The exterior or under surface embraced between the branches of the lower jaw bone, in birds.
Example Sentences:
(1) This modification allows for precision of movement, ease of repositioning, and adaptation of rigid skeletal stabilization of mobilized osseous segments in the chin.
(2) This investigation presents a commentary about two researches locating the terminal hing axis (THA) in totally edentulous people determined through the guided and not guided methods with chin compression.
(3) A case is reported of a patient with sudden onset, generalized toothache accompanied with a numb chin and lower lip.
(4) The first group was treated with functional appliances, the second with Begg light wire, and the third with chin cups.
(5) The purpose of this study was to evaluate the effects of the chin cap on bone remodeling by elucidating the characteristics and distribution of SGP at various parts on the mandible.
(6) The patient acquired this fungus by cutting his chin on a wooden floor.
(7) They win this game, it could be fear the Gillette shaved chin.
(8) The clockwise rotational movement which occurs with this treatment modality has, additionally, a favourable effect on the anterior facial height and in many cases on the position of the chin.
(9) Not all hemotympanums represent basilar skull fractures, especially when they occur in association with chin trauma.
(10) The victim was named yesterday as Tyrone Donovan Gilbert, of Longsight, Manchester, who was drinking with more than 100 other friends of Ucal Chin, also 23, killed in a drive-by shooting last month.
(11) Growth of the lower anterior teeth and alveolar bone compensated for the incremental vertical spaces which were induced by superior displacement of the premaxilla and inferior repositioning of the chin.
(12) It’s all well and good standing in a gallery and stroking your chin, but if you cast your eyes to the left and summon the concentration it takes to read the little rectangle of artistic blurb next to it, all of that context and explanation really helps transform that weird bit of twisted wire your kid could make into something deep and primal pulled from the soul.
(13) Injection of autologous adipose tissue removed via liposuction has been used clinically for facial contouring, the aging face, furrows, facial atrophy, acne scars, nasolabial folds, chin, and various other surgical defects.
(14) In addition, the amount of anterior displacement of the upper and lower anterior teeth were significantly larger than that of the premaxilla and the chin.
(15) Having drawn soft profile and perpendicular to face plane (Na-Pg) from the tips of lips, chin and nose, thicknesses of soft tissue are measured.
(16) We therefore measured electromyographic activation of the masseters during inspiratory resistance loading and compared it with activation of chin muscles and alae nasi in 10 normal subjects.
(17) Skeletal classifications were based on the relationship of the maxilla to the mandible; the three classifications were straight profile, retrusive chin profile, and prognathic profile.
(18) Barton then flung a half-hearted elbow at Tevez's chin or chest and the City player went down ridiculously easily.
(19) I lied to her, I said I will come,” he says, rubbing his unshaven chin.
(20) Indications in maxillo-facial surgery are the correction of "double chin" deformity and increased submental fullness after orthognathic surgical procedures as mandibular setback, as well as an adjunct to rhytidectomy.
Chinchilla
Definition:
(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.