What's the difference between chinchilla and fur?

Chinchilla


Definition:

  • (n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
  • (n.) The fur of the chinchilla.
  • (n.) A heavy, long-napped, tufted woolen cloth.

Example Sentences:

  • (1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
  • (2) EVNs are studied in the chinchilla by means of HRP tract tracer.
  • (3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
  • (4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
  • (5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
  • (6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
  • (7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
  • (8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
  • (9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
  • (10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
  • (11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
  • (12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
  • (13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
  • (14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
  • (15) Chinchillas were sensitized with human serum albumin (HSA).
  • (16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
  • (17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
  • (18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
  • (19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
  • (20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.

Fur


Definition:

  • (n.) The short, fine, soft hair of certain animals, growing thick on the skin, and distinguished from the hair, which is longer and coarser.
  • (n.) The skins of certain wild animals with the fur; peltry; as, a cargo of furs.
  • (n.) Strips of dressed skins with fur, used on garments for warmth or for ornament.
  • (n.) Articles of clothing made of fur; as, a set of furs for a lady (a collar, tippet, or cape, muff, etc.).
  • (n.) Any coating considered as resembling fur
  • (n.) A coat of morbid matter collected on the tongue in persons affected with fever.
  • (n.) The soft, downy covering on the skin of a peach.
  • (n.) The deposit formed on the interior of boilers and other vessels by hard water.
  • (n.) One of several patterns or diapers used as tinctures. There are nine in all, or, according to some writers, only six.
  • (a.) Of or pertaining to furs; bearing or made of fur; as, a fur cap; the fur trade.
  • (v. t.) To line, face, or cover with fur; as, furred robes.
  • (v. t.) To cover with morbid matter, as the tongue.
  • (v. t.) To nail small strips of board or larger scantling upon, in order to make a level surface for lathing or boarding, or to provide for a space or interval back of the plastered or boarded surface, as inside an outer wall, by way of protection against damp.

Example Sentences:

  • (1) Homozygotes have sparse greasy fur and lower viability and fertility than normal littermates.
  • (2) At the fepB operator, a 31 base-pair Fur-protected region was identified, corresponding to positions -19 to +12 with respect to the transcriptional start site.
  • (3) The capacity (Bmax) for [3H]ketanserin binding was significantly lower (-21%; p less than 0.05) in sparse fur animals than in control animals; there was no change in affinity (KD).
  • (4) The fusion was prepared in multicopy (pVLN102 plasmid) and low-copy-number states, the latter constructed as a lambda phage lysogen carrying a fur'-'lacZ insert.
  • (5) So that you know he's evil, he is dressed like a giant, bedraggled grey duckling, in a fur coat made up of bits of chewed-up wolf.
  • (6) The responsible allergens are contained in the urine, saliva, and secretions of furred animals.
  • (7) And I have come to tell you this: the trends for this coming season will be extremely expensive furs, very high-heeled shoes and full-length ballgowns.
  • (8) The film-maker had been due to present his new film Venus in Fur , which stars his wife, Emmanuelle Seigner, at an outdoor screening in Locarno’s Piazza Grande on Thursday.
  • (9) He was fined £800 and ordered to pay £3,500 costs by the Furness and District Magistrate court after being prosecuted by the CAA.
  • (10) The Fur protein was isolated in a single step by immobilized metal-ion-affinity chromatography over zinc iminodiacetate agarose.
  • (11) If that effect existed in small animals, they would lose less heat if nude than if fur or feathers were present.
  • (12) Regulation by iron occurs at the transcriptional level and is mediated by a ferrous iron binding protein designated Fur (ferric uptake regulation).
  • (13) Instrumental neutron activation analysis has been used for an initial evaluation of trace element content in samples of northern fur seal (Callorhinus ursinus) from the Pribilof Islands.
  • (14) Junípero Serra's road to sainthood is controversial for Native Americans Read more When the King of Spain sent Jesuit priests to prevent Russian fur hunters from claiming the region, he directed them to educate and baptize native peoples so they could become Spanish citizens, but Serra had other plans.
  • (15) The results show that transcription of the fur gene is initiated from at least two different sites separated by 6 bp, which appear to originate from two overlapping promoters sensitive to catabolic activation.
  • (16) He throws confessions about his love of guns or his lust for violence into restaurant conversations, but his inanely sophisticated companions carry on conversing about the varieties of sushi or the use of fur by leading designers.
  • (17) Thus, the pattern of sensory innervation in the glabrous rat snout skin is similar to that found in other furred species described to date, but in addition, the sensory innervation of ridged skin in the rat also resembles that of epidermis organized into rete pegs.
  • (18) 5-Fluorouridine (100 microM, 26 micrograms ml-1) inhibited contraction of human fibroblasts by more than 80%, whereas only 10 microM (2.6 micrograms ml-1) 5-FUR was required for 90% inhibition of rabbit fibroblast contraction.
  • (19) In contrast, after weaning they showed a significant increment in the duration of face-washing, head-washing, fur licking and body-scratching.
  • (20) The other was David York, branch secretary of the Association of Teachers and Lecturers and an organiser of the anti-academy protest in Barrow-in-Furness.

Words possibly related to "chinchilla"