(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.
Gopher
Definition:
(n.) One of several North American burrowing rodents of the genera Geomys and Thomomys, of the family Geomyidae; -- called also pocket gopher and pouched rat. See Pocket gopher, and Tucan.
(n.) One of several western American species of the genus Spermophilus, of the family Sciuridae; as, the gray gopher (Spermophilus Franklini) and the striped gopher (S. tridecemlineatus); -- called also striped prairie squirrel, leopard marmot, and leopard spermophile. See Spermophile.
(n.) A large land tortoise (Testudo Carilina) of the Southern United States, which makes extensive burrows.
(n.) A large burrowing snake (Spilotes Couperi) of the Southern United States.
Example Sentences:
(1) Heterochromatin is a dominant component of the genome in the bottae group of the pocket gopher genus Thomomys, having had a major role in the karyotypic evolution of member species.
(2) The protein synthesis intensity essentially grows after animals arousing and their body temperature elevation, ten times exceeding the level of the studied process in hibernating gophers.
(3) Kris Engskov's first job was as a gopher in a busy office with punishing hours and he would often nip out to grab the coffees if there was a crisis and the boss had to work late.
(4) All 90 montane voles examined were positive for Giardia, as were 4 pocket gophers, 1 water shrew, 4 water voles, and 2 meadow voles.
(5) Partial inhibition of the respiratory chain of liver mitochondria of active gophers by antimycin A which causes a decrease in the uncoupled respiration rate and delta psi down to values typical of mitochondria of hibernating gophers, practically exactly reproduced the suppression of oxidative phosphorylation and energy-dependent uptake of cations observed during hibernation.
(6) The content of glucose in the brain of the normothermal gophers (61.2 mg.) is 3,4 times as high as in the rat brain.
(7) In hibernating gophers the maximal rate of the uncoupled respiration and the ionic conductivity of the inner mitochondrial membrane were markedly decreased as compared with awakening gophers.
(8) Three prairie rattlesnakes (Crotalus viridis viridis) and two gopher snakes (Pituophis melanoleucus sayi) from the eastern high plains of New Mexico (USA) were examined for parasites.
(9) The diversity in cranial morphology of living geomyoids, including pocket gophers (Thomomys), spiny pocket mice (Heteromys and Liomys), desert pocket mice (Chaetodipus and Perognathus), and kangaroo rats and mice (Dipodomys and Microdipodops) is accompanied by only a few differences in their cephalic arterial circulation.
(10) It was concluded that partial deenergization arising as a result of inhibition of the respiratory chain is the main and unique cause of suppression of energy-dependent functions of liver mitochondria of hibernating gophers.
(11) In 2007 Winehouse married Blake Fielder-Civil, a part-time gopher for a music video company with whom she had been having an on-off tempestuous relationship.
(12) A strategy of back-to-back experimentation, originally proposed by Gopher and Sanders (1984), is reiterated and an example of a back-to-back study is described.
(13) At all the studied stages of artificial hypothermia as well as at 15 and 30-day hibernation (5 degrees C) the amount of glucose of the gopher brain remains at a relatively high level (41.6-101.5 mg%).
(14) Whether he engaged any other labour force (to be drowned) and how he obtained the necessary supplies of gopher wood and pitch is not recorded.
(15) Odor stimulation of the nose in the box turtle and the gopher tortoise produced a characteristic series of slow potentials in the olfactory bulb which were referred to as the odor evoked response.
(16) The intensity of [14C]leucine incorporation into heart, liver, brain, muscle, and blood plasma protein in gophers under deep artificial hypothermia has been studied.
(17) Intensity of the protein synthesis is studied in cells of different organs and tissues of hibernating, arousing and active gophers and rats.
(18) Concentrations of total acid-soluble phosphates were 50-75% higher in gophers than in rats, while bicarbonate values were within the normal mammalian range.
(19) Behavioral tests of hearing and sound localization in the North American pocket gopher (Geomys bursarius) show that it is unique among mammals.
(20) A derived response method of acquiring frequency specific auditory evoked potentials that utilizes a pure tone in combination with a toneburst is applied to the measurement of hearing sensitivity in guinea pigs, chinchillas and pocket gophers.