What's the difference between chinchilla and love?

Chinchilla


Definition:

  • (n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
  • (n.) The fur of the chinchilla.
  • (n.) A heavy, long-napped, tufted woolen cloth.

Example Sentences:

  • (1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
  • (2) EVNs are studied in the chinchilla by means of HRP tract tracer.
  • (3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
  • (4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
  • (5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
  • (6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
  • (7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
  • (8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
  • (9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
  • (10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
  • (11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
  • (12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
  • (13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
  • (14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
  • (15) Chinchillas were sensitized with human serum albumin (HSA).
  • (16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
  • (17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
  • (18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
  • (19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
  • (20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.

Love


Definition:

  • (n.) A feeling of strong attachment induced by that which delights or commands admiration; preeminent kindness or devotion to another; affection; tenderness; as, the love of brothers and sisters.
  • (n.) Especially, devoted attachment to, or tender or passionate affection for, one of the opposite sex.
  • (n.) Courtship; -- chiefly in the phrase to make love, i. e., to court, to woo, to solicit union in marriage.
  • (n.) Affection; kind feeling; friendship; strong liking or desire; fondness; good will; -- opposed to hate; often with of and an object.
  • (n.) Due gratitude and reverence to God.
  • (n.) The object of affection; -- often employed in endearing address.
  • (n.) Cupid, the god of love; sometimes, Venus.
  • (n.) A thin silk stuff.
  • (n.) A climbing species of Clematis (C. Vitalba).
  • (n.) Nothing; no points scored on one side; -- used in counting score at tennis, etc.
  • (n.) To have a feeling of love for; to regard with affection or good will; as, to love one's children and friends; to love one's country; to love one's God.
  • (n.) To regard with passionate and devoted affection, as that of one sex for the other.
  • (n.) To take delight or pleasure in; to have a strong liking or desire for, or interest in; to be pleased with; to like; as, to love books; to love adventures.
  • (v. i.) To have the feeling of love; to be in love.

Example Sentences:

  • (1) The Trans-Siberian railway , the greatest train journey in the world, is where our love story began.
  • (2) I'm not sure Tolstoy ever worked out how he actually felt about love and desire, or how he should feel about it.
  • (3) To many he was a rockstar, to me he was simply 'Dad', and I loved him hugely.
  • (4) She loved us and we loved her.” “We would have loved to have had a little grandchild from her,” she says sadly.
  • (5) My thoughts are with all those who have lost loved ones or been injured in this barbaric attack.
  • (6) Such a decision put hundreds of British jobs at risk and would once again deprive Londoners of the much-loved hop-on, hop-off service.
  • (7) Quotes Justin Timberlake: "Even more importantly customers love it … over 20 million listening on iTunes Radio, listened to over a billion songs.
  • (8) Clute and Harrison took a scalpel to the flaws of the science fiction we loved, and we loved them for it.
  • (9) "I loved being a man-woman," he says of the picture.
  • (10) True Love Impulse Body Spray, Simple Kind to Skin Hydrating Light Moisturiser and VO5 Styling Mousse Extra Body marked double-digit price rises on average across the four chains.
  • (11) There is a heavy, leaden feeling in your chest, rather as when someone you love dearly has died; but no one has – except, perhaps, you.
  • (12) But I know the full story and it’s a bit different from what people see.” The full story is heavy on the extremes of emotion and as the man who took a stricken but much-loved club away from its community, Winkelman knows that his part is that of villain; the war of words will rumble on.
  • (13) But in Annie Hall the mortality that weighs most heavily is the mortality of his love affair.
  • (14) Ultimately, both Geffen and Browne turned out to be correct: establishing the pattern for Zevon's career, the albums sold modestly but the critics loved them.
  • (15) Case histories Citing some or all of the following cases makes you look knowledgeable: * Wilson v Love (1896) established that a charge was a penalty if it did not relate to the true cost of an item.
  • (16) He loved that I had a politics degree and a Masters.
  • (17) The people who will lose are not the commercial interests, and people with particular vested interests, it’s the people who pay for us, people who love us, the 97% of people who use us each week, there are 46 million people who use us every day.” Hall refused to be drawn on what BBC services would be cut as a result of the funding deal which will result in at least a 10% real terms cut in the BBC’s funding.
  • (18) About 250 flights were taken off the Friday morning board at Dallas-Fort Worth International Airport and Dallas Love Field.
  • (19) Mr Bae stars in a popular drama, Winter Sonata, a tale of rekindled puppy love that has left many Japanese women hankering for an age when their own men were as sensitive and attentive as the Korean actor.
  • (20) The Commons will love it,” Chairman Jez Cor-Bao had said.

Words possibly related to "chinchilla"