(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.
Nocturnal
Definition:
(a.) Of, pertaining to, done or occuring in, the night; as, nocturnal darkness, cries, expedition, etc.; -- opposed to diurnal.
(a.) Having a habit of seeking food or moving about at night; as, nocturnal birds and insects.
(n.) An instrument formerly used for taking the altitude of the stars, etc., at sea.
Example Sentences:
(1) We evaluated the circadian pattern of gastric acidity by prolonged intraluminal pHmetry in 15 "responder" and 10 "nonresponder" duodenal ulcer patients after nocturnal administration of placebo, ranitidine, and famotidine.
(2) Both treatments depressed nocturnal pineal melatonin content in rats and hamsters.
(3) Nocturnal ST segment changes were abolished in six patients on atenolol, in six patients on nifedipine, and in five patients on isosorbide mononitrate.
(4) Stage REM frequently appeared within 10 min of stage 1 onset and the normal sequence of stages REM and 4 were altered, demonstrating that the organization of sleep within a nap is quite different from that in monophasic nocturnal sleep.
(5) The drug proved to be of high value in alleviating nocturnal coughing controlling spastic bronchitis in children, as a pretreatment before bronchological examinations and their anaesthesia.
(6) A statistically significant difference (p less than 0.01) was found between salmeterol and the association for this criteria: during the first period, 46% of subjects treated by salmeterol did not present nocturnal awakenings during the last treatment week by comparison with 15% of subjects taking the association; during the second period, corresponding figures were 39% for salmeterol by comparison with 26% for the association.
(7) Results from studies show that there can be a general hangover the morning following nocturnal doses of 2 mg.
(8) Nafarelin also allows assessment of the bioactivity of endogenous gonadotropin, is a more potent stimulus of pituitary-testicular function than endogenous GnRH secretion, and is more cost-effective than nocturnal sampling.
(9) Nocturnal penile tumescence results correlated well with the angiographic picture.
(10) One type of short-axon horizontal cell (HC) and one type of axonless HC are described in the retina of Carinae noctua, a crepuscular bird and Tyto alba, a pure nocturnal bird.
(11) When administered to adult patients with urge incontinence (generally as a 25mg twice-daily dose) terodiline reduces diurnal and nocturnal micturition frequency and incontinence episodes.
(12) To determine what effect higher nocturnal STC would have in patients with chronic obstructive pulmonary disease (COPD) on overnight lung function, oxygen saturation, and sleep quality, two different theophylline products were used to give higher or lower STC during the night.
(13) A diagnosis of paroxysmal nocturnal hemoglobinuria may be suggested with magnetic resonance imaging, based on the massive renal cortical hemosiderosis that occurs in this disease.
(14) No IgE circadian rhythm was validated in healthy children while a large amplitude (approximately equal to 30% of the 24 hours mean) circadian rhythm with 2 diurnal peaks and a nocturnal trough was demonstrated (P less than 0.0023) in the asthmatics.
(15) These results extend the scope of immunologic circadian rhythms to the reticuloendothelial system as a feature of a bioperiodic defense mechanism, most active during the habitual rest light span of nocturnally active mice.
(16) The degree of change was comparable during the diurnal and nocturnal periods.
(17) The administration of vitamin E, a natural antioxidant, to a patient with paroxysmal nocturnal haemoglobinuria (PNH) failed to diminish the urinary excretion of 59-Fe as monitored by 59-Fe whole body counting and urinary loss of isotope.
(18) Sleep percentages were higher when recordings were done during the nocturnal period.
(19) In comparison with age-matched normal controls, the fragile-X group showed lower melatonin values and a significant impairment of the nocturnal rise in this hormone.
(20) Accordingly, the effect of alpha-adrenergic stimulation and anticholinergic suppression was found to be insufficient to achieve nocturnal continence in patients with ileocaecal bladder replacement.