(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.
Ostrich
Definition:
(n.) A large bird of the genus Struthio, of which Struthio camelus of Africa is the best known species. It has long and very strong legs, adapted for rapid running; only two toes; a long neck, nearly bare of feathers; and short wings incapable of flight. The adult male is about eight feet high.
Example Sentences:
(1) Occasionally, I have been invited to try exotic meats, ostrich say, or kangaroo or alligator.
(2) A neurophysin has been isolated from ostrich neurohypophyses and shown by partial amino acid sequence determination to be related to mammalian VLDV-neurophysin.
(3) The Texan first-term senator also revealed that he had swapped his usual ostrich-skin "argument boots" for a pair of black tennis shoes after taking advice from Rand Paul, who staged a shorter filibuster last year against US drone strikes.
(4) But if it wasn't the first Lou Reed record, Do the Ostrich was certainly the most remarkable at the time.
(5) Cowhide and goatskin are used to make Mulberry goods, as well as ostrich leather and alligator skins.
(6) As part of this study the N-terminal amino acid sequences of bull frog, sea turtle, turkey, and ostrich alpha-subunits were determined and reported for the first time.
(7) The microclimate of the nest and the rates of egg water loss were studied at weekly intervals throughout the 41-day incubation period in six ostrich nests.
(8) Glucose, triglyceride, gamma-glutamyltransferase, and cholinesterase concentrations in ostriches were not linearly associated with age.
(9) But between the ostriches who want to retain the status quo and those radicals who want to lead an exodus is an interesting, and fertile, ground.
(10) He ended his life as unknowable and contrary as the 22-year-old who made Do the Ostrich.
(11) Binding and spectroscopic properties of ostrich neurophysins were examined with emphasis on the behavior of Tyr-35, a residue that provides a potential probe of the monomer-monomer interface and of allosteric interrelationships between this region and the binding site.
(12) Young ostriches had significantly lower concentrations of hematocrit, hemoglobin concentration, calcium, and magnesium, and higher levels of total protein and potassium, than the adult individuals.
(13) The complete amino acid sequence of chicken ACTH (39 residues) has been determined as NH2-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Arg-Lys-Arg- Arg- Pro-Ile-Lys-Val-Tyr-Pro-Asn-Gly-Val-Asp-Glu-Glu-Ser-Ala-Glu-Ser-Tyr-Pro- Met-Glu-Phe-OH Strikingly the amino acid sequence of chicken ACTH shows a closer resemblance to that from an amphibian, Xenopus (3 residue substitution) than that from another bird, the ostrich (7 residue substitution) or the turkey (at least 9 residue substitution).
(14) The different homogeneous ostrich neurophysin fractions so obtained were compared i.t.o.
(15) It is likely that these two forms of GnRH are present in all bird species, since the chicken and the ostrich have evolved separately.
(16) Facebook Twitter Pinterest Dress of dyed ostrich feathers and hand-painted microscopic slides.
(17) The extent of reassociation of 3H-labeled repetitive or single copy DNA sequences from the chicken with excess unlabeled DNA from the duck, the Japanese quail, and the ostrich, respectively, was measured by hydroxylapatite chromatography.
(18) This study also demonstrates that the ostrich copeptin is more closely related to the amphibian copeptin sequence than to its mammalian homologue, leading to the hypothesis that two families of copeptin molecules might exist.
(19) Rex Hunt, fully dressed in his governor's tights and ostrich plumes, was widely seen, not least by toffs in the Foreign Office (FCO), as a slightly Wodehousian figure, the kind more likely to be seen in slacks propping up the golf club bar in a colonial outpost.
(20) The effect of calcium ions and enzyme concentration on the rate of self-digestion of ostrich trypsin was also investigated.