(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.
Pet
Definition:
(n.) A cade lamb; a lamb brought up by hand.
(n.) Any person or animal especially cherished and indulged; a fondling; a darling; often, a favorite child.
(n.) A slight fit of peevishness or fretfulness.
(a.) Petted; indulged; admired; cherished; as, a pet child; a pet lamb; a pet theory.
(v. t.) To treat as a pet; to fondle; to indulge; as, she was petted and spoiled.
(v. i.) To be a pet.
Example Sentences:
(1) In cases with unilateral hypoperfusion, the percentage of the activity in the lesion to that in the contralateral normal cortex on the early SPECT was correlated well with that on CBF measured by PET (r = 0.870, p less than 0.001).
(2) However, localizing a functional region with PET has been severely limited by the poor resolving properties of PET devices.
(3) The PET studies suggest dysfunction of the prefrontal cortex as a result of damage to the lentiform nuclei.
(4) If the PET measurement is commenced prior to arteriovenous equilibrium, significant errors occur in calculated CBV.
(5) Single photon emission computed tomography (SPECT) and positron emission tomography (PET) are now being used to improve the information available from radioisotopic imaging of patients with cancer.
(6) The muscarinic receptor agonist carbachol had no significant effects on [3H]PEt and [3H]IP formation in nontransfected HEK cells.
(7) Appropriate corrections for atrophy should be employed if current PET scanners are to accurately measure actual brain tissue metabolism in various pathologic states.
(8) Using a 1-stage random-digit dial telephone survey, we estimated the number of pet dogs and cats and cancer case ascertainment in the principal catchment area of an animal tumor registry in Indiana, the Purdue Comparative Oncology Program (PCOP).
(9) Such information could be most useful for in vivo receptor visualization studies using positron emission tomography (PET) scanning.
(10) Half the adolescents completed the child maltreatment instrument first, while the rest completed the pet maltreatment instrument.
(11) In this study, PET images were obtained using [18F]-labeled fluorodeoxyglucose, a marker for glucose metabolism.
(12) The global black market in animal and plants, sold as food, traditional medicines and exotic pets, is worth billions and sees an estimated 350 million specimens traded every year.
(13) The distribution of 1-11C-acetoacetic acid after injection into adult Wistar rats and cats was investigated by PET.
(14) If we start letting movie stars – even though they’ve been the sexiest man alive twice – to come into our nation (with pets), then why don’t we just break the laws for everybody?” Joyce said at the time.
(15) We have developed a method that allows two sets of regional cerebral metabolic rates of glucose (rCMRglc) to be obtained in a single extended procedure using positron emission tomography (PET) and [18F]fluorodeoxyglucose (FDG).
(16) Metabolic PET studies also give insight into pathophysiologic mechanisms of epilepsy.
(17) In view of the number of PET studies involving low count rate acquisitions, there has been increasing interest recently in the development of positron cameras capable of fully three-dimensional acquisition and reconstruction.
(18) We performed dynamic positron emission tomographic (PET) studies of glucose utilization, using (18F) 2-fluoro-2-deoxy-D-glucose (FDG), in patients with probable Alzheimer's disease (AD) and healthy age-matched controls, to evaluate blood-brain-barrier glucose transport and glucose utilization rates in the disease.
(19) We used a 11C-glucose method for positron emission tomography (PET) while estimating cerebral glucose metabolism during human sleep with polysomnography (PSG).
(20) His mother is Denise Welch, late of Corrie and Loose Women, and his father his Tim Healy, who was briefly famous 30 years ago for his role in Auf Wiedersehen, Pet.