(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.
Prize
Definition:
(n.) That which is taken from another; something captured; a thing seized by force, stratagem, or superior power.
(n.) Anything captured by a belligerent using the rights of war; esp., property captured at sea in virtue of the rights of war, as a vessel.
(n.) An honor or reward striven for in a competitive contest; anything offered to be competed for, or as an inducement to, or reward of, effort.
(n.) That which may be won by chance, as in a lottery.
(n.) Anything worth striving for; a valuable possession held or in prospect.
(n.) A contest for a reward; competition.
(n.) A lever; a pry; also, the hold of a lever.
(v. t.) To move with a lever; to force up or open; to pry.
(v. t.) To set or estimate the value of; to appraise; to price; to rate.
(v. t.) To value highly; to estimate to be of great worth; to esteem.
(n.) Estimation; valuation.
Example Sentences:
(1) In January 2011, the Nobel peace prize laureate was admitted to a Johannesburg hospital for what officials initially described as tests but what turned out to be an acute respiratory infection .
(2) The night's special award went to armed forces broadcaster, BFBS Radio, while long-standing BBC radio DJ Trevor Nelson received the top prize of the night, the gold award.
(3) The 61-year-old paid to transport prize-winning children to the fair in St Thomas and funded their accommodation.
(4) After winning his prize, Malcolm Turnbull must learn from Abbott's mistakes Read more Abbott appointed Warren Mundine to head his hand picked advisory council on Indigenous affairs.
(5) An Artist of the Floating World won the Whitbread Book of the Year award and was nominated for the Booker prize for fiction; The Remains of the Day won the Booker; and When We Were Orphans, perceived by many reviewers as a disappointment, was nominated for both the Booker and the Whitbread.
(6) Three scientists, George Wald, Ragnar Granit, and Haldan Keffer Hartline, were named last week to share the 1967 Nobel prize in medicine or physiology.
(7) The agency notes, too, that the Norwegian broadcaster NRK has form when it comes to announcing peace prize winners early, saying last year the EU had triumphed an hour before the official announcement.
(8) Concern for the future and belief in scientific progress provided the motive for the foundation of the Prize which, in our time, is one of the most coveted of honours.
(9) The launch of M-Farm followed a €10,000 (about £8,500) investment prize.
(10) The young woman is Nobel Peace Prize winner Ellen Johnson-Sirleaf, then part of the new guard of dissidents and critics, now the president of Liberia.
(11) How can a prize that is supposed to be for one person be given to an amorphous supranational organisation?
(12) But there was a shock with the Jury prize, which went to Polisse, one of the four films in competition directed by a woman.
(13) For many, free movement is the price that has to be paid for the prize of single market membership.
(14) GNM accepts no responsibility for any costs associated with the prize that are not expressly included in the prize.
(15) The IPCC is charged with providing a scientific, balanced assessment about what's known and what's known about climate change There are lots of organisations ringing bells The IPCC is more like a belltower, which people can climb up to get a clear view 8.41am BST Al Gore , the former US vice-president and winner of the Nobel peace prize for his work on climate change , has responded to the IPCC report by saying it shows the need for a switch to low carbon sources of energy (note his emphasis is on mitigation, i.e.
(16) Peter Vipond, director of regulation and tax at the Association of British Insurers, said: "We are concerned that so far none of the bodies will have a statutory objective to maintain London's competitiveness as a global financial sector – this is too valuable a prize to be thrown away."
(17) Boyle, who on Sunday night received an outstanding contribution prize at the Empire awards, said he was not a fan of stereoscope on film and doubted it would survive.
(18) The possible reasons why Kitasato lost the first Nobel Prize for medicine to von Behring are presented.
(19) The Tasmanian writer said he was “stunned” to be in the running for the prestigious UK-based literary prize, which for the first time has been opened to authors of any nationality.
(20) But NS&I has announced that it is cutting the prize fund rate from 1 May, although the chances of winning a prize will remain the same at 30,000-1 as the number of £25 prizes will increase.