(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.
Rat
Definition:
(n.) One of several species of small rodents of the genus Mus and allied genera, larger than mice, that infest houses, stores, and ships, especially the Norway, or brown, rat (M. decumanus), the black rat (M. rattus), and the roof rat (M. Alexandrinus). These were introduced into America from the Old World.
(n.) A round and tapering mass of hair, or similar material, used by women to support the puffs and rolls of their natural hair.
(n.) One who deserts his party or associates; hence, in the trades, one who works for lower wages than those prescribed by a trades union.
(v. i.) In English politics, to desert one's party from interested motives; to forsake one's associates for one's own advantage; in the trades, to work for less wages, or on other conditions, than those established by a trades union.
(v. i.) To catch or kill rats.
Example Sentences:
(1) All rats were examined in the conscious, unrestrained state 12 wk after induction of diabetes or acidified saline (pH 4.5) injection.
(2) It was tested for recovery and separation from other selenium moieties present in urine using both in vivo-labeled rat urine and human urine spiked with unlabeled TMSe.
(3) It is supposed that delta-sleep peptide along with other oligopeptides is one of the factors determining individual animal resistance to emotional stress, which is supported by significant delta-sleep peptide increase in hypothalamus in stable rats.
(4) The microsomal preparations from untreated Syrian golden hamster livers exhibited higher activities of N-demethylation towards the macrolide antibiotics, erythromycin and troleandomycin, than those from untreated and phenobarbital-treated rats.
(5) Phospholipid methylation in human EGMs is distinctly different from that in rat EGMs (Hirata and Axelrod 1980) in that the human activity is not Mg++-dependent, and apparent methyltransferase I activity is located in the external membrane surface.
(6) Biochemical, immunocytochemical and histochemical methods were used to study the effect of chronic acetazolamide treatment on carbonic anhydrase (CA) isoenzymes in the rat kidney.
(7) In conclusion, in S-rats a glucose-stimulated insulin release is accompanied by an increase in IBF, but this is not observed in P-rats.
(8) Competition with the labelled 10B12 MAb for binding to the purified antigen was demonstrated in sera of tumor-bearing and immune rats.
(9) Nutritionally rehabilitated animals had similar numbers of nucleoli to control rats.
(10) This study examined the [3H]5-HT-releasing properties of 3,4-methylenedioxymethamphetamine (MDMA) and related agents, all of which cause significant release of [3H]5-HT from rat brain synaptosomes.
(11) Addition of phospholipase A2 from Vipera russelli venom led to a significant increase in the activity of guanylate cyclase in various rat organs.
(12) Spontaneous locomotor activity was lower in naloxone-infused rats on day 3 only.
(13) The LD50 of the following metal-binding chelating drugs, EDTA, diethylenetriaminepentaacetic acid (DTPA), hydroxyethylenediaminetriacetic acid (HEDTA), cyclohexanediaminotetraacetic acid (CDTA) and triethylenetetraminehexaacetic acid (TTHA) was evaluated in terms of mortality in rats after intraperitoneal administration and was found to be in the order: CDTA greater than EDTA greater than DTPA greater than TTHA greater than HEDTA.
(14) We have investigated a physiological role of endogenous insulin on exocrine pancreatic secretion stimulated by a liquid meal as well as exogenous secretin and cholecystokinin octapeptide (CCK-8) in conscious rats.
(15) The subcellular distribution of sialyltransferase and its product of action, sialic acid, was investigated in the undifferentiated cells of the rat intestinal crypts and compared with the pattern observed in the differentiated cells present in the surface epithelium.
(16) However, the groups often paused less and responded faster than individual rats working under identical conditions.
(17) After 55 days of unrestricted food availability the body weight of the neonatally deprived rats was approximately 15% lower than that of the controls.
(18) To examine the central nervous system regulation of duodenal bicarbonate secretion, an animal model was developed that allowed cerebroventricular and intravenous injections as well as collection of duodenal perfusates in awake, freely moving rats.
(19) In the present investigation we monitored the incorporation of [14C] from [U-14C]glucose into various rat brain glycolytic intermediates of conscious and pentobarbital-anesthetized animals.
(20) Gel filtration of the 40,000 rpm supernatant fraction of a homogenate of rat cerebral cortex on a Sepharose 6B column yielded two fractions: fraction II with the "Ca(2+) plus Mg(2+)-dependent" phosphodiesterase activity and fraction III containing its modulator.