(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.
Soft
Definition:
(superl.) Easily yielding to pressure; easily impressed, molded, or cut; not firm in resisting; impressible; yielding; also, malleable; -- opposed to hard; as, a soft bed; a soft peach; soft earth; soft wood or metal.
(superl.) Not rough, rugged, or harsh to the touch; smooth; delicate; fine; as, soft silk; a soft skin.
(superl.) Hence, agreeable to feel, taste, or inhale; not irritating to the tissues; as, a soft liniment; soft wines.
(superl.) Not harsh or offensive to the sight; not glaring; pleasing to the eye; not exciting by intensity of color or violent contrast; as, soft hues or tints.
(superl.) Not harsh or rough in sound; gentle and pleasing to the ear; flowing; as, soft whispers of music.
(superl.) Easily yielding; susceptible to influence; flexible; gentle; kind.
(superl.) Expressing gentleness, tenderness, or the like; mild; conciliatory; courteous; kind; as, soft eyes.
(superl.) Effeminate; not courageous or manly, weak.
(superl.) Having, or consisting of, a gentle curve or curves; not angular or abrupt; as, soft outlines.
(superl.) Not tinged with mineral salts; adapted to decompose soap; as, soft water is the best for washing.
(superl.) Applied to a palatal, a sibilant, or a dental consonant (as g in gem, c in cent, etc.) as distinguished from a guttural mute (as g in go, c in cone, etc.); -- opposed to hard.
(superl.) Belonging to the class of sonant elements as distinguished from the surd, and considered as involving less force in utterance; as, b, d, g, z, v, etc., in contrast with p, t, k, s, f, etc.
(n.) A soft or foolish person; an idiot.
(adv.) Softly; without roughness or harshness; gently; quietly.
(interj.) Be quiet; hold; stop; not so fast.
Example Sentences:
(1) In conclusion, the efficacy of free tissue transfer in the treatment of osteomyelitis is geared mainly at enabling the surgeon to perform a wide radical debridement of infected and nonviable soft tissue and bone.
(2) Bilateral symmetric soft-tissue masses posterior to the glandular tissue with accompanying calcifications should suggest the diagnosis.
(3) None of the other soft tissue layers-ameloblasts, stratum intermedium or dental follicle--immunostain for TGF-beta 1.
(4) The cotransfected cells do not grow in soft agar, but show enhanced soft agar growth relative to controls in the presence of added aFGF and heparin.
(5) It was hypothesized that compensatory restraining influences of surrounding soft tissues prevented a more severe facial malformation from occurring.
(6) After the diagnosis of a soft-tissue injury (sprain, strain, or contusion) has been made, treatment must include an initial 24- to 48-hour period of RICE.
(7) It is a specific clinical picture with extensive soft tissue gas and swelling of the forearm.
(8) Benign and malignant epithelial and soft tissue tumors of the skin were usually negatively stained with MoAb HMSA-2.
(9) The patient, a 12 year-old boy, showed a soft white yellowish mycotic excrescence with clear borders which had followed the introduction of a small piece of straw into the cornea.
(10) In open fractures especially in those with severe soft tissue damage, fracture stabilisation is best achieved by using external fixators.
(11) A distally based posterior tibial artery adipofascial flap with skin graft was used for the reconstruction of soft tissue defects over the Achilles tendon in three cases and over the heel in three cases.
(12) The third patient was using an extended-wear soft contact lens for correction of residual myopia.
(13) Computed tomography (CT) is the most sensitive radiologic study for detecting these tumors, which usually are small, round, sharply marginated, and of homogeneous soft tissue density.
(14) The latter indicated that, despite the smaller size of the digital image, they were adequate for resolving clinically significant soft-tissue densities.
(15) We isolated soft agar colonies (a-subclones) and sub-clones from foci (h-subclones) of both hybrids, and, as a control, subclones of cells from random areas without foci of one hybrid (BS181 p-subclones).
(16) Three of the tumours represented primary soft tissue lesions, while locally recurrent tumour or pulmonary metastases were studied from the 4 skeletal tumours, all of which had been diagnosed previously as Ewing's sarcomas.
(17) The technique is based on a multiple regression analysis of the renal curves and separate heart and soft tissue curves which together represent background activity.
(18) A hospital-based case-control study on soft tissue sarcomas (STS) was conducted in 1983-84 in Torino and in Padova (Italy).
(19) This phenomenon can have a special significance for defining the vitality in inflammation of bone tissue, in burns and in necrosis of soft tissues a.a. of the Achilles tendon.
(20) Thirty patients required a second operation to an area previously addressed reflecting inadequacies in technique, the unpredictability of bone grafts, and soft-tissue scarring.