(n.) A thickening of the epidermis at some point, esp. on the toes, by friction or pressure. It is usually painful and troublesome.
(n.) A single seed of certain plants, as wheat, rye, barley, and maize; a grain.
(n.) The various farinaceous grains of the cereal grasses used for food, as wheat, rye, barley, maize, oats.
(n.) The plants which produce corn, when growing in the field; the stalks and ears, or the stalks, ears, and seeds, after reaping and before thrashing.
(n.) A small, hard particle; a grain.
(v. t.) To preserve and season with salt in grains; to sprinkle with salt; to cure by salting; now, specifically, to salt slightly in brine or otherwise; as, to corn beef; to corn a tongue.
(v. t.) To form into small grains; to granulate; as, to corn gunpowder.
(v. t.) To feed with corn or (in Sctland) oats; as, to corn horses.
(v. t.) To render intoxicated; as, ale strong enough to corn one.
Example Sentences:
(1) Previous attempts to purify this enzyme from the liquid endosperm of kernels of Zea mays (sweet corn) were not entirely successful owing to the lability of partially purified preparations during column chromatography.
(2) First, it has diverted grain away from food for fuel, with over a third of US corn now used to produce ethanol and about half of vegetable oils in the EU going towards the production of biodiesel.
(3) Dry matter and starch intakes were greater when corn was fed than when barley was fed.
(4) Development of folate deficiency was evaluated in young chicks fed diets containing corn and soybean meal as major constituents.
(5) Changes in haemolymph juvenile hormone (JH) concentrations of larvae of the southwestern corn borer, Diatraea grandiosella, were used to estimate the activity of the corpora allata.
(6) In Experiment 1, chicks 24 days old were fed mixtures of untreated and inoculated corn containing citrinin to provide 0, 50, 100, 150, 200, and 250 micrograms of the toxin per gram of blended corn.
(7) Mice administered chloroform in corn oil displayed a significant degree of diffuse parenchymal degeneration (5 of 10 males and 1 of 10 females) and mild to moderate early cirrhosis (5 of 10 males and 9 of 10 females); significant pathological lesions were not observed in the animals administered corn oil without chloroform nor in mice receiving chloroform in 2% Emulphor.
(8) Ammoniation of corn, peanuts, cottonseed, and meals to alter the toxic and carcinogenic effects of aflatoxin contamination has been the subject of intense research effort by scientists in various government agencies and universities, both in the United States and abroad.
(9) It was found that ammoniation inactivated the aflatoxins and reduced the carcinogenicity of the contaminated corn to a level that was not significantly different from that with the basal control diet.
(10) Ribosome-inactivating proteins were found in high amounts in one line of cells of Phytolacca americana (pokeweed) cultured in vitro and, in less quantity, in lines of Saponaria officinalis (soapwort) and of Zea mays (corn) cells.
(11) Two-day-old poults were fed diets containing no added fat [44.6% starch, 2.2% ether extract by weight (HC)], 10% tallow (T), or 10% corn oil [(CO) 29.0% starch, 10.9% ether extract].
(12) Free fatty acids from both coconut and corn oils reduced diet palatability and intake; those from tallow and coconut oil markedly interfered (in vitro) with rennet clotting of milk replacers.
(13) They dealt in dozens of different commodities – from major grains such as wheat and sorghum to specialised food aid products such as corn-soy blend.
(14) Rats fed tryptophan-poor corn diets have reduced levels of brain serotonin and show increased responsiveness to electric shock.
(15) Percent apparent digestibilities for DM, NDF, and N for corn and corn-sunflower were similar and greater than for sunflower: DM (69.6, 68.2, 57.4); NDF (68.1, 61.5, 51.6); and N (66.3, 66.5, 63.6).
(16) Compared to fiber-free, feeding corn bran increased binding in the duodenum 30% and ileum 50% but decreased binding in the jejunum 44%, and feeding guar gum increased binding in the colon 73% but decreased binding in the jejunum 40%.
(17) Corn oil feeding decreased the transcriptional rate.
(18) Rats whose diet was restricted in calories by 40% exhibited no mammary tumors (coconut oil as primary dietary fat) or 75% fewer tumors (corn oil as dietary fat) compared to ad libitum-fed controls; they also exhibited 47% fewer colonic tumors.
(19) Anthracene, chrysene, benzo(e)pyrene and perylene did not significantly suppress the antibody-forming cell response compared to the corn oil vehicle controls.
(20) Acarbose significantly reduced the satiety effect of corn starch in lean rats (p less than 0.001), and further attenuated satiety in obese rats (p less than 0.02).
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).