(1) In a 2013 Politifact interview , the author of the Urban Institute study, Stan Dorn, said: “It makes sense that as time goes by … health insurance coverage has greater impact on health outcomes.” The specific numbers might be hard to agree upon, and even harder to forecast if the Republican bill is passed.
(2) Dorn, G. (Albert Einstein College of Medicine, New York, N.Y.), and W. Rivera.
(3) It is now perhaps more widely known as a backdrop for the kingdoms of Dorne and Meereen in Game of Thrones.
(4) Dorne, a part of the Seven Kingdoms, sends the second son of its ruling family to attend the upcoming Royal Wedding, as a calculated insult.
(5) The sedimentation potential or the Dorn effect occurs when heavy particles fall in a liquid.
(6) Previous studies in this laboratory have led to the identification of the 47-kDa cell binding protein of the AF, using the monoclonal antibody (mab) 5D2-D11 [Gramzow M, Bachmann M, Zahn RK, Uhlenbruck G, Dorn A, Müller WEG, J Cell Biol, 102: 1344-1349, 1986].
(7) A questionnaire was sent to diplomates of the American Board of Endodontics to determine changing trends in the treatment of endodontic emergencies since Dorn's survey 10 yr ago.
(8) In this paper the theory is used to interpret H. B. Dorn's data on the incidence of 21 kinds of cancer in both male and female Americans.
(9) This article describes a system of adverse drug reaction (ADR) reporting implemented at WJB Dorn Veterans Affairs (VA) Hospital, Columbia, South Carolina, which involves reviewing all inpatient charts by medical record technicians for possible ADRs and notifying the chief pharmacist for investigation.
(10) The oblique parasagittal diameter of the lumbar spinal canal at the L5-S1 level was measured in 49 employees of the Wm Jennings Bryan Dorn Veterans' Hospital using real time ultrasound in a case-control study.
(11) "Certainly the most destructive part of the Bush environmental legacy is not only his failure to act on global climate change, but his administration's covert attempt to silence the science alerting us to the urgency of the problem," said Jonathan Dorn of the Earth Policy Institute (EPA) in Washington.
(12) All spinach r-proteins that cross-reacted with antisera to chloroplast-synthesized r-proteins of C. reinhardtii are known to be made in the chloroplast (Dorne et al.
(13) In this article, we estimate accelerated time-to-failure and proportional-hazard functions with about 100,000 members of the Dorn sample, finding greater hazards associated with smoking and some dependence on occupational variables that measure risk and physical activity.
(14) A cohort of nearly 300,000 insured veterans (Dorn Cohort), experienced a much greater percent decline in CHD death rate over the period, 1954-1979, than the population of the U.S., while for stroke, the percent decline in death rate was virtually the same as the U.S. For CHD, greater percent declines were noted over the study period for non-smokers compared to cigarette smokers, for professionals compared to non-professionals and for persons with high socioeconomic scores (SES) compared to those with low scores.
(15) Use of the needle-catheter feeding jejunostomy at Richland Memorial Hospital and the Dorn Veterans Administration Hospital, both clinical teaching institutions of the University of South Carolina School of Medicine, has been evaluated in 114 patients ranging from 20 to 90 years old.
(16) In a much-cited 2013 study , for example, economists David Autor of MIT and David Dorn of Spain’s CEMFI institute found that because computers could now be substituted for low-skill workers performing routine tasks (book-keeping, clerical work and repetitive production and monitoring activities) we were going to see a “hollowing-out” of middle-skilled, middle-wage jobs and “a corresponding rise in employment at both the high and low ends of the skills spectrum”.
(17) We analyzed the 1986 National Mortality Followback Survey, a sample of 18,733 U.S. death certificates, and the 1954-1962 Dorn study, a follow-up study of approximately 250,000 holders of U.S. Veterans Life Insurance.
(18) Two german physicians, Andreas Röschlaub and Anton Dorn, were against this project; they realised the possible results to man's health.
(19) Hypotheses about the extent, persistence, and constancy for different causes of the healthy worker effect are evaluated using the data of the Dorn Study of Mortality Among US Veterans.
(20) As the Dorne prince menacingly says to Tyrion: "Tell your father I'm here!
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).