(n.) A hard, projecting, and usually pointed organ, growing upon the heads of certain animals, esp. of the ruminants, as cattle, goats, and the like. The hollow horns of the Ox family consist externally of true horn, and are never shed.
(n.) The antler of a deer, which is of bone throughout, and annually shed and renewed.
(n.) Any natural projection or excrescence from an animal, resembling or thought to resemble a horn in substance or form; esp.: (a) A projection from the beak of a bird, as in the hornbill. (b) A tuft of feathers on the head of a bird, as in the horned owl. (c) A hornlike projection from the head or thorax of an insect, or the head of a reptile, or fish. (d) A sharp spine in front of the fins of a fish, as in the horned pout.
(n.) An incurved, tapering and pointed appendage found in the flowers of the milkweed (Asclepias).
(n.) Something made of a horn, or in resemblance of a horn
(n.) A wind instrument of music; originally, one made of a horn (of an ox or a ram); now applied to various elaborately wrought instruments of brass or other metal, resembling a horn in shape.
(n.) A drinking cup, or beaker, as having been originally made of the horns of cattle.
(n.) The cornucopia, or horn of plenty.
(n.) A vessel made of a horn; esp., one designed for containing powder; anciently, a small vessel for carrying liquids.
(n.) The pointed beak of an anvil.
(n.) The high pommel of a saddle; also, either of the projections on a lady's saddle for supporting the leg.
(n.) The Ionic volute.
(n.) The outer end of a crosstree; also, one of the projections forming the jaws of a gaff, boom, etc.
(n.) A curved projection on the fore part of a plane.
(n.) One of the projections at the four corners of the Jewish altar of burnt offering.
(n.) One of the curved ends of a crescent; esp., an extremity or cusp of the moon when crescent-shaped.
(n.) The curving extremity of the wing of an army or of a squadron drawn up in a crescentlike form.
(n.) The tough, fibrous material of which true horns are composed, being, in the Ox family, chiefly albuminous, with some phosphate of lime; also, any similar substance, as that which forms the hoof crust of horses, sheep, and cattle; as, a spoon of horn.
(n.) A symbol of strength, power, glory, exaltation, or pride.
(n.) An emblem of a cuckold; -- used chiefly in the plural.
(v. t.) To furnish with horns; to give the shape of a horn to.
(v. t.) To cause to wear horns; to cuckold.
Example Sentences:
(1) After calving, probably the position of new follicles is temporally influenced by direct signals from the uterine horns affected differently by pregnancy.
(2) Severity of leukoaraiosis around the frontal horns of the lateral ventricles correlated significantly with severity of leukoaraiosis of the centrum semiovale adjacent to the bodies of the lateral ventricles.
(3) Spinal cord stimulation would suppress at least the dorsal horn neurons which were destroyed by various kinds of diseases.
(4) This study presents data supporting a selective antinociceptive role for DA at the spinal level, where it has a widespread antinociceptive influence, on cells in both the superficial and deeper dorsal horn.
(5) On Days 12-14 each gilt received twice daily infusions of Day 15 pCSP in one uterine horn and SP in the other uterine horn.
(6) In 25 rabbits, endometrium from the right uterine horn was transplanted onto the peritoneum (Experimental group = Group E).
(7) Differential pulse voltammetry used in combination with an electrochemically treated carbon fiber electrode allowed the detection of 5-hydroxyindoles (5-HI) in the dorsal horn of the urethane-anesthetized rat.
(8) Uterine blood flow to both uterine horns was measured by microsphere and by tritiated water steady-state diffusion methodology.
(9) But Hey Diddly Dee, in Sky Arts' latest Playhouse Presents season, could only manage 71,000 viewers, despite the combined star power of Kylie Minogue, David Harewood, Peter Serafinowicz and Mathew Horne.
(10) A few with low endometrial receptor levels had normal livers but at least one sterile uterine horn.
(11) It is concluded that chronic peripheral nerve section affects the anatomical and physiological mechanisms underlying the formation of light touch receptive fields of dorsal horn neurons in the lumbosacral cord of the adult cat, but that the resulting reorganization of receptive fields is spatially restricted.
(12) The concordance for this disease in these two patients of nonconsanguineous parentage with no family history of the disorder suggests the possibility of sublethal intrauterine injury to anterior horn cells.
(13) Subpopulations of DRG neurones that subserve distinct sensory modalities project to discrete regions in the dorsal horn.
(14) Phospholipase A2 has been purified from the venom of Horned viper (Cerastes cerastes) by gel permeation chromatography followed by reverse-phase HPLC.
(15) In ventral horn motoneurons and neurons of nucleus dorso-medialis (C1) pronounced staining was found after a total dosage of 1200 micrograms HgCl2.
(16) The influence of embryos on growth of the uterus was determined by comparing uterine length, weight and diameter between gravid and nongravid horns within unilaterally pregnant gilts.
(17) Postmortem examination showed axonal pathology of the anterior horns and roots of the spinal cord, and white matter hypoplasia of the brain.
(18) Histochemically the lowered activity of enzymes was localized mainly in the neuropil of: striatum, the Broc's nuclei and rhinencephalon: in the nervous cells of: Ammon's horn, nuclei of thalamus and in neocortex.
(19) Thyrotropin releasing hormone (TRH) has been identified recently in fibers and cell bodies in the dorsal horn of the spinal cord, but its function in the dorsal horn is not known.
(20) With immunocytochemical techniques, SP immunoreactivity (SP-I) and CGRP-I were localized in myometrial nerves throughout the uterine horns, with nerves immunoreactive for CGRP being the more numerous.
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).