What's the difference between lorn and orn?

Lorn


Definition:

  • (a.) Lost; undone; ruined.
  • (a.) Forsaken; abandoned; solitary; bereft; as, a lone, lorn woman.

Example Sentences:

  • (1) Clodia Metelli The epitome of the chic, sexy, scandalous aristocrat of 1st century BC Rome, Metelli was supposedly the "Lesbia" to whom the love-lorn poems of Catullus are addressed (and if so, a total ball-breaker).
  • (2) But given that Che followed his fringe run with a year where he got hired first by Jon Stewart for The Daily Show, and then by Lorne Michaels to become a cast member on Saturday Night Live (he had originally been one of the show’s writers), it’s possible that those judges knew less about comedy than they thought.
  • (3) Louis (Herbert Lorn) is the dangerously unassimilated foreigner.
  • (4) Lorne Craner, president of IRI, said that Egyptian officials quizzed about the no-fly policy had told the institute that they were still completing their investigations following the December raids and that they might "go to trial soon".
  • (5) He has had access to Pete Cowan for coaching advice at home, moreover, and it was that link which provided him with his caddie for the week, Lorne Duncan, who has more than 30 years' experience on the European Tour.
  • (6) Lorne Campbell, artistic director, Northern Stage In 2005, when I was an assistant director at the Traverse, my fringe consisted of chewing my way through a very long list of shows that needed to be seen "just in case".
  • (7) Facebook Twitter Pinterest Lorning Cornish shouts after Baltimore authorities released a report on the death of Freddie Gray while police in riot gear stand guard.
  • (8) Angry citizens, for their part, must acknowledge the dangers police face on the job, the president said at an interfaith memorial service for Michael Smith, Lorne Ahrens, Michael Krol, Patrick Zamarripa and Brent Thompson, the officers killed by Micah Johnson at a rally against police violence on Thursday night .
  • (9) Easdale, off Seil Island, Argyll & Bute Size: 0.08sq miles In its mid-19th century heyday, this apparently inconsequential island in the Sound of Lorn had a population of around 450 and was exporting up to 19m roofing slates every year, laying the basis for the boast that Easdale's was "the slate that roofed the world".
  • (10) That brought them to the attention of legendary Saturday Night Live producer Lorne Michaels.
  • (11) Information was gathered from patients presenting to the surf club, hospital, surgery and pharmacy with injuries sustained on or around Lorne beach, Victoria.
  • (12) Having Trump not just make a guest appearance but actually host the show validates that SNL, executive producer Lorne Michaels, NBCUniversal and its sponsors don’t really care at all about “respect and dignity for all people”.
  • (13) He has found out the lines that seem to dignify his own love-lorn feelings.
  • (14) Michael Lorne, a Rastafarian lawyer, has vowed not to include Jamaican universities in plans for cultivation and research, for fear that middlemen will swipe the profits.
  • (15) The Congressional Hispanic Caucus calls upon NBCUniversal, Broadway Video, and SNL Executive Producer Lorne Michaels to disinvite Mr Trump from hosting Saturday Night Live because racism is not funny.” Representative Xavier Becerra, who is chairman of the House Democratic Caucus, is among the politicians who have criticised Trump’s appearance.

Orn


Definition:

  • (v. t.) To ornament; to adorn.

Example Sentences:

  • (1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
  • (2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
  • (3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
  • (4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
  • (5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
  • (6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
  • (7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
  • (8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
  • (9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
  • (10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
  • (11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
  • (12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
  • (13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
  • (14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
  • (15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
  • (16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
  • (17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
  • (18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
  • (19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
  • (20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).

Words possibly related to "orn"