(n.) The first part of the day; the morning; -- used chiefly in poetry.
Example Sentences:
(1) This was carried out on the healthy subjects for a total of 12 nights without medication (control nights asleep), a total of 12 nights following 40 mg of flucortolone the previous morning, and a total of 6 nights with similar blood sampling when sleep was prevented (control nights awake).
(2) That’s when you heard the ‘boom’.” Teto Wilson also claimed to have witnessed the shooting, posting on Facebook on Sunday morning that he and some friends had been at the Elk lodge, outside which the shooting took place.
(3) He also challenged Lord Mandelson's claim this morning that a controversial vote on Royal Mail would have to be postponed due to lack of parliamentary time.
(4) But we sent out reconnoitres in the morning; we send out a team in advance and they get halfway down the road, maybe a quarter of the way down the road, sometimes three-quarters of the way down the road – we tried this three days in a row – and then the shelling starts and while I can’t point the finger at who starts the shelling, we get the absolute assurances from the Ukraine government that it’s not them.” Flags on all Australian government buildings will be flown at half-mast on Thursday, and an interdenominational memorial service will be held at St Patrick’s cathedral in Melbourne from 10.30am.
(5) When we arrived, he would instruct us to spend the morning composing a song or a poem, or inventing a joke or a charade.
(6) The morning papers, like many papers last week, were full of stories about Brown's survival chances.
(7) Blood pressure, heart rate and adverse reactions were recorded every 2 weeks in the morning before drug intake.
(8) When I told my friend Rob that I was coming to visit him in Rio, I suggested we try something a bit different to going to the beach every day and drinking caipirinhas until three in the morning.
(9) The announcement of Dame Helen Ghosh's departure from the top job at the Home Office the morning after the Olympics is likely to leave Whitehall looking "maler and paler".
(10) Fleeting though it may have been (he jetted off to New York this morning and is due in Toronto on Saturday), there was a poignant reason for his appearance: he was here to play a tribute set to Frankie Knuckles, the Godfather of house and one of Morales's closest friends, who died suddenly in March.
(11) It is concluded from the data that the composition of morning urine of apparently healthy probands adequately reflects excretion of 24 hours.
(12) According to Australian Associated Press the woman made an official complaint to police on Wednesday morning and supplied some evidence.
(13) He told strikers at St Thomas’ hospital, London: “By taking action on such a miserable morning you are sending a strong message that decent men and women in the jewel of our civilisation are not prepared to be treated as second-class citizens any more.
(14) Domino’s had been in touch with Driscoll on Thursday morning and was “working to make it up to him ... and to ensure he is not out of pocket for any expenses incurred”.
(15) The babies were weighed prior to the morning feeding.
(16) We have examined the serum MT response in the male hamster to a single dose of 25 micrograms MT administered in the morning or in the afternoon--the same timing and dose used by others to produce reproductive effects.
(17) When Fox woke up one morning in 1990 and noticed his little finger shaking, he thought it was a side effect of a hangover.
(18) There was instead a significant relationship between starting FEV1 and histamine PC20 in the morning and in the afternoon both after placebo and fenoterol.
(19) This is the grim Fury on a rainy winter morning in Cannes.
(20) The responses were scored hourly up to 4 hours after the administration of single doses in the morning to subjects with persistent cough.
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).