(1) To resolve the apparent contradiction between Norn's work on human eyes suggesting that postoperative air protects the corneal endothelium and the work of Leibowitz on excised animal eyes suggesting that air damages the corneal endothelium, we have replicated Norn's findings in an animal model similar to that used by Leibowitz.
(2) This technique has been compared with that using the standardized Norn-pipette collecting fluid from the lateral part of the inferior fornix.
(3) Since fewer metabolically active cells may maintain corneal deturgesence even after cell loss we do not believe that Norn's work contradicts that of Leibowitz.
(4) N is also for Nibelungs , the race of dwarfs who live in the subterranean world of Nibelheim in the Ring cycle, and for Norns , three daughters of the earth goddess Erda who have a walk-on (or more usually sit-down) part in the Ring, where they are engaged in weaving the rope of destiny.
(5) November 8, 2013 David Buik (@truemagic68) What a messy set of Norn-farm Payrolls!
(6) 12.02pm: Sky's Norn Ironish correspondent Lawrie Sanchez looks glum and thinks his country's chances of finishing in the top two of their group with Italy, Serbia, Estonia, Slovenia and the Faroe Islands are slim.
(7) The methods of examination by which lacrimal insufficiency can be confirmed are discussed: Schirmer's test (I and II), Jones' test, Norn's dilution test, break-up time, tests with dyes such as fluorescein, rose bengal, and lissamine green 1%.
(8) Basophils were isolated with Day's technique modified by Shov and Norn.
(9) Possible cytological changes of the conjunctival fluid in association with physical activity were studied in a series of 39 subjects practising aerobics, 22 football players, and 29 marathon runners by means of the quantitative pipette method and the qualitative stix method of Norn.
(10) The Norn Lacrimal Dilution test showed increased tear flow after the climate-chamber exposures (P less than 0.05).
(11) to Norn 79%, and 55% for a standardized dilution (2.5 microliters of water) in the same pipette.
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).