(n.) A money of account among the Anglo-Saxons, valued, in the Domesday Book, at twenty pence sterling.
(pl. ) of Os
Example Sentences:
(1) The necrotic retinal neurons are substituted by mitotic processes in the outer nuclear layer and the marginal growth zone at the ora serrata.
(2) Daily injection of OrA-2, 1 h prior to hMG into 10-day-old female rats for 4 days caused a significant inhibition of hMG-induced estradiol secretion.
(3) This study reports 14 patients who presented proliferative vitreoretinopathy (PVR) at stages III to IV, as well as ora dialysis or large retinal breaks of such extent that it was evident that implanted silicone oil would penetrate behind the retina.
(4) Ora; ciprofloxacin was studied as a prophylactic antimicrobial agent in high- and low-risk patients undergoing endoscopic retrograde cholangiography.
(5) He said Ora last week scrapped a reality series it was working on with Trump’s companies last week.
(6) Such sera positive for Chikungunya HI antibodies were further screened against other circulating alphaviruses of which 17 or 25% were positive to Igbo-Ora virus, 6 or 38.1% to Semliki forest virus and 36 or 52.6% were positive to Sindbis virus.
(7) Only a few nuclei near the ora serrata were labeled in retinas from kittens injected at three weeks after birth, and no labeled neurons were found in kittens injected at four weeks.
(8) A geometrical method of calculating retinal magnification factor at the limits of the retinal field, adjacent to the ora terminalis, is described.
(9) This method also yields good results in determining the total saponins in P. ginseng ora solution.
(10) As the eye grows the mitotic zone occupies a progressively smaller and more distal proportion of the increasing radius; by P5 only the region near the ora serrata is highly active, with some additional mitotic cells trailing into a broad central zone.
(11) Therefore, we concluded that when cryotherapy is used to treat lattice degeneration, an adequate margin of surrounding retina should be treated and the treatment should extend to the ora serrata.
(12) Hyalinoid thickening was found in the ora serrata, which does not reflect the changes of the intracerebral arteries.
(13) This utilitarian feature allows the surgeon to eliminate residual anteroposterior traction following complete membrane peeling by extending relaxing retinotomies and tacking the posterior cut edge of the retina securely between the ora serrata and the equator.
(14) Women are dead (McAdams), betrayed (Laurence) or embittered (Rita Ora, on hand as a “tough junkie with a kid to protect”, according to Harvey Weinstein).
(15) The feasibility of autologous transplantation of retinal pigment epithelial (RPE) cells from just posterior to the ora serrata to the posterior pole was demonstrated in the rabbit model.
(16) Rita Ora: I Will Never Let You Down Another general-use tune, and one whose reassuring words will haunt any politician just as effectively as they haunt Rita Ora in the wake of her romantic split from the song’s writer, Calvin Harris.
(17) I won’t try to replicate this; I have to write records that I’d play in my sets rather than something that I think will do well.” So he’s not about to start producing for Rita Ora?
(18) Using an anti-human S-100 protein antibody, the Müller cells of the retina of the monkey Macacus irus were immunostained in the neural retina and in the ora serrata.
(19) Few labeled cells were detectable in the INL at day 9; these were found close to the ora serrata.
(20) Study 1: the patients were examined pre and post-treatment (with ora oxamniquine) and the following exams were performed: sputum for eosinophils and chest x-ray.
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).