(n.) A spherical body; a globe; especially, one of the celestial spheres; a sun, planet, or star.
(n.) One of the azure transparent spheres conceived by the ancients to be inclosed one within another, and to carry the heavenly bodies in their revolutions.
(n.) A circle; esp., a circle, or nearly circular orbit, described by the revolution of a heavenly body; an orbit.
(n.) A period of time marked off by the revolution of a heavenly body.
(n.) The eye, as luminous and spherical.
(n.) A revolving circular body; a wheel.
(n.) A sphere of action.
(n.) Same as Mound, a ball or globe. See lst Mound.
(n.) A body of soldiers drawn up in a circle, as for defense, esp. infantry to repel cavalry.
(v. t.) To form into an orb or circle.
(v. t.) To encircle; to surround; to inclose.
(v. i.) To become round like an orb.
Example Sentences:
(1) Matt Roller (@rolldiggity) A lot of people say the Orb is evil.
(2) The same Twitter account directed people last week to envelopes with $50 and $100 inside them in San Francisco and 36 cash-filled "Angry Birds orbs" in Hermosa Beach, California.
(3) FitBug Orb and Kik Plans The FitBug Orb, released last year, makes fitness trackers more affordable at under £50.
(4) So while in Japan you can easily stumble across a remote-control tissue box or a battery-operated planetarium for your bathroom (by which I mean a waterproof Saturn-shaped orb that floats in the bath and projects the entire visible universe onto the ceiling), the sense of surrounding novelty has diminished.
(5) In the movie, Peter Quill forms an uneasy alliance with a group of misfits who are on the run after stealing a coveted orb.
(6) Isn’t that a good thing?” But an ORB opinion poll for the Independent found 76% believe the party has become less electable since the general election while 24% believe the party has become more electable.
(7) In contrast, Orbeli used the salivary conditional reflex method, which he considered to be more precise than the method that relied on erratic movements of a dog.
(8) Pavlov's disciples L. A. Orbeli and N. I. Krasnogorskiĭ had considered the ontogenetic development of language.
(9) I was doing an interview for one of those pop keyboard magazines, and the guy said to me ‘What do you think of The Orb?’ And I said ‘What’s The Orb?’ And he said ‘You don’t know?’ And I said ‘No I don’t know,’ and he said ‘You should know,’ and he handed me the CD and I took it home there was Electric Counterpoint.
(10) Better yet, when you kill anything with your special weapon it floods the area with orbs, a social currency that can be picked up by your team mates and used to quickly charge their own specials.
(11) The ORB and PSS articulator settings obtained from the two techniques were compared and the following conclusions drawn.
(12) But the ORB Telegraph poll put remain on 55% and leave trailing on 42% among people who definitely intend to vote.
(13) I will negotiate with the Orb, make it work for us.
(14) Dark, compound orbs on a yellow speckled head, joined to a winged, segmented body.
(15) Two distinct families of low-molecular-weight toxins (argiotoxins) have been isolated from the venom of the orb-web spider.
(16) Much was made of the royal couple's modernity (the aeroplanes, radio and television), and the young Queen's femininity, able to juggle children and a handbag, along with the crown of state and orb and sceptre.
(17) Iwant to walk on the Moon, kick up the fine dust and watch it gently settle on my boot, and see the sparkling blue orb of the Earth rise over the horizon.
(18) This is related to his being on the crinkly side of 60 but mostly, I suspect, it's a perception that he'd got ratty and weary inside Norman Foster's glassy orb .
(19) The speaker means this as a good thing, yet questions inevitably bubble up: just where did said orbs go, and who wielded the offending secateurs?
(20) Uber France boss Thibaud Simphal called the raid a “disproportionate action carried out on a very fragile legal basis” in comments to L’Orbs magazine.
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).