(1) The ORD titrations of ApAp(3') and CpCp(3'), which were made by measuring the ORD curves at closely spaced pH intervals, exhibit a maximum at approx.
(2) Sir Hugh Orde, Acpo's president, said on Friday the introduction of police commissioners would create "inevitable tension" with chief constables over local and national policing priorities.
(3) Ironically, Hogan-Howe in part owes the job to Orde, who managed to persuade the home secretary to oppose Downing Street's plan to bring in Bill Bratton, the former US police chief, to run the Met.
(4) The absolute configuration of a novel chiral neuroleptic agent SU 23397 (I) was determined by ORD comparison of (+)-5-methoxy dihydro coumarilic acid (VIII), a synthetic precursor of SU 23397 (I), with (+)-dihydro coumarilic acid, whose absolute configuration is known.
(5) Although the Acpo statement today was more measured, its president, Sir Hugh Orde, has warned in recent months that low turnouts would risk returning BNP candidates and even "lunatics" as police commissioners.
(6) Experimental differences in the curves of the optic rotation dispersion (ORD) of cystrans-heptaenic antibiotics were found.
(7) After a brief introduction of the ORD and CD methods, the advantages and drawbacks of the application of the two methods have been described, and compared, and the calibration of ORD and CD instruments have been given.
(8) ORD spectra of hybrid viruses, reconstituted from RNA of one virus and coat protein of another, proved to be identical to the ORD of the virus, whose protein was used in reconstitution.
(9) The ORD and CD spectra of the analogs are similar to those of the natural oligonucleotides.
(10) We have a problem already and, to my mind, if we allow access to countless millions without any means or ability of checking who they are, we’re adding to a problem that already exists within our countries.” But Orde, one of the most respected figures in policing, says the anti-EU campaigners have “misused the horrific events in Paris to try to support their failing cause.
(11) In ORD measurements, the rotatory behaviors of lysozyme and its derivative were identical at the 233 nm negative minimum and the 199 nm positive extremum.
(12) Gel chromatography and ORD measurements show no strong conformational change.
(13) $200m will be set aside for a water infrastructure fund and a further $20m on the feasibility of dams and infrastructure projects in northern Australia, including the third stage of the Ord river venture.
(14) In addition, one of them was found to have approximately 15% alpha-helical conformation by the Moffitt-Yang analysis of ORD data.
(15) Analysis of the ORD and CD spectra of various glycosaminoglycans, as well as those of oversulphated and desulphated preparations allowed the following conclusions concerning the secondary structure.
(16) Sir Hugh Orde, the president of the Association of Chief Police Officers, last week played down allegations of a cover-up.
(17) Although simple nearest-neighbour calculations based on the ORD data of IpIp(3') and 5'-IMP account for the observed ORD spectrum of polyinosinic acid at low salt concentration, there were large discrepancies between calculated and experimental results of the polyguanylic acid ORD even at low ionic strength.
(18) A model is developed which shows that studies of the effect of radiation on ORD properties may be useful in providing information on possible intermediate steps in protein denaturation.
(19) The study shows that the stereochemical configuration of lipids isolated from biological material can be assessed by ORD and CD.
(20) It is perhaps unsurprising, then, that Kevin Rudd has promised to “unlock” the Northern Territory, including by expanding stage three of the Ord River irrigation scheme.
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).