(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).
Torn
Definition:
(p. p.) of Tear
() p. p. of Tear.
Example Sentences:
(1) The logistics of maintaining and supplying underground clinics located in war-torn rural Afghanistan are presented.
(2) Never had I heard anything about what I saw documented so unsparingly in Evan’s photographs: families sleeping in the streets, their clothes in shreds, straw hats torn and unprotecting of the sun, guajiros looking for work on the doorsteps of Havana’s indifferent mansions.
(3) The shredded fibres were trimmed in most cases and this allowed better definition of the amount of ligament considered to be torn.
(4) This 90s pop confection had torn tights, a sulky attitude and high regard for Quentin Tarantino.
(5) Plibersek on Thursday ruled out supporting sending ground troops into Syria, after the government announced on Wednesday that it would extend airstrikes into the war-torn country .
(6) We hurtled into Barcelona at speeds that should have torn Eglantine's juddering Peugeot 205 apart.
(7) Some of these are functions that would once have been taken on through squatting – and sometimes still are, as at Open House , a social centre recently and precariously opened in London's Elephant & Castle, an area torn apart by rampant gentrification, where estates are flogged off to developers with zero commitment to public housing and the aforementioned "shopping village" is located in a derelict estate.
(8) The capsule is reattached to the boney rim of the anterioinferior glenoid deep to and lateral to the torn cartilagenous labrum, thus excluding the labrum from the joint anteriorly.
(9) Nine pedunculated benign synoviomata causing mechanical symptoms similar to those of a torn meniscus are described.
(10) The UNHCR estimates there are more than 60 million forcibly displaced people worldwide, with over 4 million Syrians alone leaving their war-torn country to seek safety in neighbouring countries and Europe.
(11) David Cameron has attacked Labour's "rank hypocrisy" in calling for him to boycott the Commonwealth summit in Sri Lanka as he claimed his visit to the country's war-torn north will help give a voice to the dispossessed.
(12) 'I am all the African chiefs who have sold their continent to the white men' … Samuel Fosso's self-portrait as an African chief The life work of one of Africa's most important living photographers and contemporary artists, Samuel Fosso , has been rescued from destruction after his studio and home were attacked by looters in war-torn Central African Republic .
(13) Arthroscopic operative procedures include the inspection of a torn glenoid labrum and certain lesions of the biceps tendon, viewing a torn rotator cuff, locating loose bodies in the shoulder, surgery for recurrent dislocations, and division of the coracoacromial ligament.
(14) Although not within the scope of this article, acute arthroscopic repair of a torn meniscus, evaluation of the degree of tear of the anterior cruciate ligament, and arthroscopic repair of osteochondral fractures are all benefited by acute arthroscopic examination.
(15) Jelacic's plans are to impact the tribunal's work in a country more torn than at any time during the war: "They involve entrenching the current outreach offices and moving the operation and the defence lines from The Hague to the Balkans: not just to Sarajevo, Zagreb, Belgrade and Pristina - but to the municipalities, the villages themselves.
(16) The quality of ultrasound image obtained from the patients in vivo proved similar to that obtained during the in vitro studies, and in addition six ulcerative lesions including two with torn intima were detected with transesophageal echocardiography.
(17) Those that do exist bear Saudi Arabia's logo, but they are torn and thin – leftovers from a huge aid donation during cyclone Nargis.
(18) In the marginal area, bone can be found lying open with torn remnants, which are lying free in the coagulum.
(19) The torn segment was mobile, the remainder of the meniscus stable.
(20) They also plan to disrupt the work of the crews by calling the Libyan coastguard and asking them to take migrants and refugees attempting to cross the Mediterranean back to war-torn Libya.