What's the difference between orn and urn?

Orn


Definition:

  • (v. t.) To ornament; to adorn.

Example Sentences:

  • (1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
  • (2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
  • (3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
  • (4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
  • (5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
  • (6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
  • (7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
  • (8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
  • (9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
  • (10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
  • (11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
  • (12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
  • (13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
  • (14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
  • (15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
  • (16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
  • (17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
  • (18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
  • (19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
  • (20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).

Urn


Definition:

  • (n.) A vessel of various forms, usually a vase furnished with a foot or pedestal, employed for different purposes, as for holding liquids, for ornamental uses, for preserving the ashes of the dead after cremation, and anciently for holding lots to be drawn.
  • (n.) Fig.: Any place of burial; the grave.
  • (n.) A measure of capacity for liquids, containing about three gallons and a haft, wine measure. It was haft the amphora, and four times the congius.
  • (n.) A hollow body shaped like an urn, in which the spores of mosses are contained; a spore case; a theca.
  • (n.) A tea urn. See under Tea.
  • (v. t.) To inclose in, or as in, an urn; to inurn.

Example Sentences:

  • (1) The council offered him a tea urn | Frances Ryan Read more Government attempts to decrease the disproportionately high levels of unemployment among disabled people have had little impact, the report notes, while notorious “fit-for-work” tests were riven with flaws.
  • (2) In this article we review the important statistical properties of the urn randomization (design) for assigning patients to treatment groups in a clinical trial.
  • (3) The urn cell complex of the marine invertebrate Sipunculus nudus responds to mucus-stimulating substances (MSS) in normal human lacrimal fluids and stool filtrates by producing mucus.
  • (4) Ai Weiwei’s years of small gestures, his dropped Han Dynasty urn or his coathanger portrait of Marcel Duchamp , are long behind him.
  • (5) Poststratified subgroup analyses can also be performed on the basis of the urn design permutational distribution.
  • (6) I congratulated him on the upsurge in his fortunes, such as his sideways move from squeezing, baking and daubing his filthy and infantile clay urns into broadcasting on the prestigious Channel 4 network.
  • (7) In both countries, urns still tend to be buried in cemeteries, and although many permit families to bury more than one urn in a single grave site, these still take up significant space – indefinitely.
  • (8) It was good to see the Italian family of coffee impresario Renato Bialetti housing his ashes in a totally appropriate coffee pot urn last week.
  • (9) The urn design forces a small-sized trial to be balanced but approaches complete randomization as the size of the trial (n) increases.
  • (10) A cemetery design competition in Oslo, meanwhile, gave special mention to one student’s design for a cemetery skyscraper that would reach hundreds of metres into the sky and include spaces for coffins, urns, a crematorium and a computerised memorial wall.
  • (11) Not only did Gilliam knock over the urn, sending dust everywhere, but after it had been righted it began talking-or rattling, from within, answering questions with one knock or two.
  • (12) Graduating from the tea urn to 'number boy', snapping shut the clapperboard, his appetite to learn was voracious.
  • (13) Complete randomization, permuted block procedures, and adaptive urn models are simulated in order to assess how representative the achieved distribution is for the procedure used and how other procedures would have performed on the given study population.
  • (14) Two well known continuity of care measures, the COC and SECON indices, are shown to have a simple interpretation in terms of the model parameters, and their accuracy is discussed in the light of the urn model.
  • (15) Imagine them collectively giving you policy advice over a tea urn and a platter of sandwiches.
  • (16) If there's an urn it's not porn – that's a Discworld cliché," he says, a bubble of laughter in his voice.
  • (17) The Temple offers a kaleidoscope of incense-scented mayhem, where golden centaurs and exotic urns sprawl alongside zodiac drapes and musky shrines to the Virgin Mary, Lakshmi and other female icons.
  • (18) The recent increase in Putin's publicity stunts – from riding a Harley Davidson to "discovering" ancient Greek urns while diving – is among the factors being taken as a sign he plans to return to the presidency.
  • (19) An urn model of Pólya-Eggenberger type is applied to the problem of measuring provider continuity in ambulatory care.
  • (20) Alternatively, there is an average five-year wait for a small spot in a public columbarium, where thousands of urns of cremated ashes are stored.

Words possibly related to "orn"