(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).
Worn
Definition:
(p. p.) of Wear
() p. p. of Wear.
Example Sentences:
(1) A case is presented of a 35-year-old woman who was brought to the emergency service by ambulance complaining of vomiting for 7 days and that she could not hear well because she was 'worn out'.
(2) It can also solve a lot of problems – period.” However, Trump did not support making the officer-worn video cameras mandatory across the country, as the Democratic frontrunner Hillary Clinton has done , noting “different police departments feel different ways”.
(3) Many leave banking after three to five years, not because they are 'worn out', but because now they have financial security to start their own business or go on to advocate for a cause they are passionate about or buy a small cottage in the West Country for the rest of their lives."
(4) The development of a shear transducer, small enough to be worn comfortably under a normal foot, is described, along with a microcomputer controlled data logger.
(5) Facebook Twitter Pinterest A sticker worn on the shirt an attendee at a New York City landmarks commission meeting.
(6) The police spokesman said the evidence considered included a testimony from a member of the public who witnessed the incident, footage supplied by the media, an interview with the man who was Tasered, footage from the video cameras worn by the attending officers and a statement from a safety trainer.
(7) At the present time, the following parameters can be recommended for "early diagnosis" of phosgene overexposure: Phosgene indicator paper badges, to be worn by all persons involved in handling phosgene (these badges permit immediate estimation of the exposure dose in each individual case); Observation of the initial irritative symptoms of the eye and the upper respiratory tract after phosgene inhalation can provide a rough indication of the inhalation concentration and dose; X-ray photographs of the lungs make it possible to detect incipient toxic pulmonary edema at an early stage, during the clinical latent period.
(8) Every time he felt the futility of his work for the NAACP, he’d finger the well-worn pages, and it would strengthen his resolve.” This is how classics of this calibre work their way into the literary bloodstream.
(9) In order to evaluate the usefulness of gamma-ray-irradiation to improve the tolerance to wear of the sockets, the worn surface of the 2.5 M rad gamma-ray-irradiated HDP sockets after total hip arthroplasty has been quantified by a newly-developed 3 dimensional (3-D) image analysis method in combination with scanning electron microscopy (SEM).
(10) Gloves were the barrier worn most frequently when appropriate (74%), followed by goggles (13%), gowns (12%), and masks (1%).
(11) The Pucci Saturday night show was a fairly typical glamorous display with op art prints, 70s shapes and jetset-worthy wafty dresses – all the things Dundas has done so successfully – worn by supermodels including Eva Herzigova, Karie Kloss, Joan Smalls and Natasha Poly.
(12) The etched porcelain laminate veneer is a new conservative treatment that offers a solution to fractured, discolored, and worn anterior teeth.
(13) The two reformists Mr Mousavi and Mehdi Karroubi have sought to portray themselves as the true heirs of the Islamic revolution's spiritual leader, the late Ayatollah Khomeini, but this tactic has since worn thin and Khomeini's successor Ayatollah Ali Khamenei has stepped up his drive to paint Mousavi and Karroubi as western-run heretics.
(14) The case is described of a 26-year olf woman, gravida 2, para 1, who presented with failure to conceive 18 months after revomal of a Lippes Loop IUD worn for 12 months.
(15) Designs weren’t limited to abayas (a long tunic traditionally worn by Muslim women in the Middle East).
(16) Partly for this reason, writers like Jeremy Rifkin have been saying that information privacy is a worn-out idea.
(17) Conventionally fitted Paraperm O2plus contact lenses were worn for 44 months by 23 myopic children, who discontinued lens wear for 2.5 months and then resumed lens wear with Fluoroperm 30 lenses for a period of 8 months.
(18) As the weirdly brilliant TV show Fashion Police – hosted by the late, great Joan Rivers, who, along with various randoms, passed judgment on clothes worn by celebrities that week – demonstrated, people have different takes on clothes.
(19) Like 90% of the population, all I knew about him was that he was that bloke who’d worn a dress to the Baftas.
(20) More than half of 18- to 30-year-olds say they’re worried about the future, 47% report that they lack self-confidence, and 42% that they feel worn down.