(n.) A small rodent (Chinchilla lanigera), of the size of a large squirrel, remarkable for its fine fur, which is very soft and of a pearly gray color. It is a native of Peru and Chili.
(n.) The fur of the chinchilla.
(n.) A heavy, long-napped, tufted woolen cloth.
Example Sentences:
(1) Seven peripheral vein sites were successfully venipunctured in unanaesthetized chinchillas: the femoral, cephalic, auricular, saphenous, dorsalis penis, lateral abdominal and tail veins.
(2) EVNs are studied in the chinchilla by means of HRP tract tracer.
(3) The yeast Cyniclomyces guttulatus (Saccharomycopsis guttulata) was shown in this study to line the stomach of domestic and feral rabbits, guinea pigs, and chinchillas.
(4) Right eyes of Chinchilla rabbits received Clobetasone eye drops 3 times daily over a period of consecutive 14 days.
(5) We concluded that CT will cause AOM in the chinchilla by direct inoculation into the middle ear as well as indirectly by infection of the nasopharynx and conjunctiva.
(6) Eight of the successful attempts were with E. chinchillae, which was the only truly euryxenous species of Eimeria in the group.
(7) Spectral and temporal response patterns to pure-tone stimuli were collected from single units in the dorsal cochlear nucleus of anesthetized chinchillas.
(8) The current studies were designed to investigate whether such a protective effect could be observed in chinchillas receiving ethacrynic acid.
(9) This study was designed to compare the morphologic effects of urea and glycerol on cochlear tissues, using the chinchilla as an experimental model.
(10) Chinchilla glucagon has the amino acid sequence HSQGTFTSDYSKHLDSRYAQEFVQWLMNT.
(11) Histoplasmosis was diagnosed histopathologically in a female chinchilla.
(12) A chinchilla-specific immunoassay was used to show that surviving saline-injected animals developed serum anticapsular antibody; BPIG-treated animals had no detectable response.
(13) In addition, OME was maintained for 3 weeks in seven of 17 chinchillas, boosted by intradermal and intratympanic injections at 1-week intervals.
(14) The role of GABAergic inhibitory inputs onto posteroventral cochlear nucleus (PVCN) neurons in the anesthetized chinchilla was investigated through iontophoretic application of the GABAA receptor agonist muscimol and the GABAA receptor antagonist bicuculline.
(15) Chinchillas were sensitized with human serum albumin (HSA).
(16) Recent data in the chinchilla (Relkin and Doucet, 1991), suggest that these differences may arise in part from differences in inter-stimulus recovery processes in the different spontaneous rate groups.
(17) Responses of chinchilla auditory-nerve fibers to synthesized stop consonants differing in voice onset time (VOT) were obtained.
(18) Fifty Havanna, Small Chinchilla and crossbred rabbits were each infected at 3 to 4 months of age with a single dose of 5-20 thousand third-stage larvae of the trichostrongyle.
(19) The specific effects of these particular noise-exposure parameters on the cochlear blood supply of the chinchilla will be discussed.
(20) Chinchillas were exposed to an 86 dB SPL octave band of noise centered at 4.0 kHz for 3.5--5 days.
Rodent
Definition:
(v. t.) Gnawing; biting; corroding; (Med.) applied to a destructive variety of cancer or ulcer.
(v. t.) Gnawing.
(v. t.) Of or pertaining to the Rodentia.
(n.) One of the Rodentia.
Example Sentences:
(1) Intoxicating concentrations of ethanol also inhibit excitatory synaptic transmission mediated by N-methyl-D-aspartate receptors in hippocampal slices from adult rodents.
(2) This is the first clear example of activation of the K-ras gene by ethylating agents in a rodent lung tumor system.
(3) The relatively high incidence of nephroblastoma in the Nb rat using transplacentally administered ENU appears to represent a suitable basis for developing a rodent model of human nephroblastoma or Wilms' tumor.
(4) Male Sprague Dawley rats either trained (T, N = 9) for 11 wk on a rodent treadmill, remained sedentary, and were fed ad libitum (S, N = 8) or remained sedentary and were food restricted (pair fed, PF, N = 8) so that final body weights were similar to T. After training, T had significantly higher red gastrocnemius muscle citrate synthase activity compared with S and PF.
(5) This model of protective immunity in a Brugia-susceptible small rodent may provide a useful system for identification of molecularly defined filarial-protective immunogens.
(6) The receptor pattern observed in tumors does not support the hypothesis previously raised in the case of chemically induced colonic tumors in rodents.
(7) It is concluded that these rodent studies do not implicate any specific inhalational anesthetic agent in fetal toxicity, and that the effects of additional factors, such as stress, must be considered.
(8) In the course of routinely performed subchronic toxicity studies with laboratory rodents, functional neurotoxicity, i.e.
(9) Particularly striking is the distribution of CpG dinucleotides within human and rodent APRT genes.
(10) There was less of an increase following a blood meal infected with the rodent malaria parasite, Plasmodium berghei.
(11) An analysis of 54 protein sequences from humans and rodents (mice or rats), with the chicken as an outgroup, indicates that, from the common ancestor of primates and rodents, 35 of the proteins have evolved faster in the lineage to mouse or rat (rodent lineage) whereas only 12 proteins have evolved faster in the lineage to humans (human lineage).
(12) The differences in immunoreactivity between rodent and human amyloid plaques are consistent with other findings showing that cellular genes, not infectious purified prions, encode PrP.
(13) These products, as well as several synthetic intermediates, were evaluated for antifilarial activity against Molinema dessetae either in vivo in its natural host, the rodent Proechimys oris, or in vitro by a new test using cultures of the infective larvae.
(14) An increased neuronal activity was obtained by exercising the rats in a commercial rodent treadmill a couple of hours per day for 14 days.
(15) In a series of experiments we found that 1) growth rates of hamsters offered the Lyric diet alone or in conjunction with the standard rodent diet exceeded those of hamsters offered only the standard rodent diet.
(16) A model system of exfoliated normal human cervicovaginal squamous cells, exfoliated rodent tumor cells, and acellular, viscous, mucuslike material was used to investigate cell deposition on smear preparations made with three different instruments: plastic spatulas, wooden spatulas, and brush-tipped collectors.
(17) With repeated administrations, rodents become increasingly sensitive to the stimulant properties of amphetamine, a phenomenon termed sensitization.
(18) Although the overall rate of thymidine incorporation was lower than that for rodent cells, human hepatocytes were sensitive to lower concentrations of these growth factors, and the degree of stimulation was similar.
(19) Daily cocaine injection into rodents produces a progressive increase in the motor stimulant effect of acute cocaine administration.
(20) Since PEG-1000 treatment of HPRT- Chinese hamster cells in the absence of human cells yielded no HPRT+ cells, it is concluded that the element responsible for the restoration of rodent HPRT was contributed by the human cells and not by the agent employed to promote fusion.