(1) Translation of the tnsC ORF reveals strong homology to a consensus sequence for nucleotide binding sites as well as a region of similarity to a transcriptional activator (MalT).
(2) The 912 nucleotide ORF has been identified as the cell-to-cell transport protein gene.
(3) The RNA sequence was 6791 nucleotides in length and contained four open reading frames (ORFs).
(4) DNA sequence analysis of a 3.8-kb genomic piece allowed identification of (i) an open reading frame (ORF) with striking homology to the previously identified D. melanogaster ORF and (ii) conserved sequence elements of possible regulatory relevance within and flanking the second intron.
(5) A consensus promoter sequence was found immediately 5' to the first ORF.
(6) The tat open reading frame (ORF) has a strong signal for translation initiation, while rev and vpu ORFs have weaker signals.
(7) No homology to any published protein sequence was found for the smaller ORFs.
(8) The positive-strand RNA genome of pestiviruses contains a single large open reading frame (ORF) extending its entire length and is capable of encoding 450 kDa of protein.
(9) The ten classes of mutants included (i) mutants showing abortive intracellular and extracellular growth; (ii) mutants showing abortive intracellular growth; (iii) rough mutants; (iv) mutants showing greatly reduced hemolysin and phospholipase secretion but showing normal growth in cells and little or no association with F-actin; (v) mutants with mutations mapping to an open reading frame (ORF) adjacent to hlyA and referred to as ORF U, lacking phospholipase activity, and with 50% normal hemolysin activity; (vi) mutants with reduced secretion of both hemolysin and phospholipase; (vii) nonhemolytic mutants with mutations mapping to the structural gene, hlyA; (viii) mutants with 25% normal hemolysin secretion and absolutely no association with F-actin; (ix) mutants with mutations mapping to ORF U, lacking phospholipase activity, and with normal hemolysin activity; and (x) mutants showing a mixed-plaque morphology but normal for all other parameters.
(10) The region of the AcMNPV genome encompassing EcoRI-H and -S (map positions 82.6-85.8) contains five open reading frames (ORFs) forming one transcriptional unit.
(11) We have used immunoblotting analysis to identify four protein products of orf-1.
(12) The nucleotide sequences, comprising a total of 8.6 kb, and the amino acid translations for nine predicted open reading frames (ORFs) (designated SalF4L, SalF 19R, SalF21R, B4R, B8R, B9R, B10R, and B14R) are presented.
(13) The Cs cob.1 ORF was cloned into the vector pMALcr1 and over-expressed as a hybrid protein fused to maltose-binding protein (MBP).
(14) Starting from two in-frame AUG codons (seven amino acid residues apart) an open reading frame (ORF) was identified that extended in frame into the ORF coding for the downstream E2 membrane protein gene.
(15) Oral antisecretory potency of ORF 17583 in gastric fistula dogs was 31 times greater than cimetidine, 3.7 times greater than ranitidine and equal to that of omeprazole and famotidine.
(16) sigB lay in an operon with four open reading frames (orfs) in the order orfV-orfW-sigB-orfX, and lacZ gene fusions showed that all four frames were translated in vivo.
(17) An upstream sequence surrounding the first AUG of the smaller ORF corresponds to a potentially functional initiation codon.
(18) An open reading frame (ORF) coding for a 57.3 kDa polypeptide was identified.
(19) A 591-nt ORF is located near the 5' end of MStV RNA3, while a second ORF of 948 nt is located near the 3' end in the viral complementary RNA (vcRNA).
(20) The nucleotide sequence showed two overlapping open reading frames (ORFs) within the kikA region.
Orn
Definition:
(v. t.) To ornament; to adorn.
Example Sentences:
(1) Experiments reported here show that diets containing ornithine added at an equimolar (+Orn) or five times equimolar (+5 Orn) to replace arginine in the +Arg basal diet (2.0% Arg .
(2) Culture supernatants from three different auxotypes of Neisseria gonorrhoeae, one requiring arginine, hypoxanthine, and uracil (Arg-,Hyx-,Ura-), one requiring proline, arginine (not satisfied by ornithine), and uracil (Pro-,Arg-[Orn*],Ura-), and one requiring proline (Pro-), were tested for their chemotactic activity against leukocytes from men of two racial groups, white and black.
(3) One of the side chains of Orn residues in gramicidin S (GS) was connected with alanine (AGS), sarcosine (SGS), or histidine (HGS) residue, aiming at developing membrane-active artificial enzymes by virtue of the membrane-associating property of GS.
(4) The problem of denying defendants their constitutional rights was the reason we have argued that defendants' hypnotically refreshed testimony should generally be permitted, whereas the unreliability of hypnotically elicited memories and the manner in which hypnosis diminishes the effectiveness of cross-examination make the general exclusion of testimony from hypnotized witnesses essential (M. T. Orne, 1982).
(5) Stringently replicating Orne and Scheibe's procedures, 10 subjects were exposed to conditions designed to generate expected REST effects.
(6) Replacement of the central Gly residue by a Cys one, as in the sequence depsiGly-Cys-Orn(L), was proposed subsequently, so as to further stabilize such a beta-sheet arrangement by means of a disulfide bridge between the two Cys residues.
(7) One of these compounds, the Orn analog of AMT, is the most potent FPGS inhibitor we have found to date.
(8) The ontogenetic development of the enzymes phosphate activated glutaminase (PAG), glutamate dehydrogenase (GLDH), glutamic-oxaloacetic-transaminase (GOT), glutamine synthetase (GS), and ornithine-delta-aminotransferase (Orn-T) was followed in cerebellum in vivo and in cultured cerebellar granule cells.
(9) Corresponding analogues containing an Asp (or Glu) residue in the 2-position and an Orn (or Lys) residue in the 4-position showed similar selectivity relationships, but better agreement between bio- and binding assay data.
(10) Two peptide-based affinity inactivators Ac-Leu-(BrAc)Orn-Arg-Ala-Ser-Leu-Gly (4) and Ac-Leu-Arg-(BrAc)Orn-Ala-Ser-Leu-Gly (5) were prepared as probes for the study of the nature of the active-site residues in the catalytic subunit of cyclic AMP dependent protein kinase.
(11) The products were potent inhibitors of purified dihydrofolate reductase (DHFR) from L1210 murine leukemia cells, with IC50's ranging from 0.027 and 0.052 microM as compared with 0.072 microM for APA-L-Orn.
(12) The distance between the terminal NE atoms of the Orn residues is 5.7 A.
(13) The physiologic damage of ORN is based on a compromised blood supply and altered metabolism of bone formation secondary to effects of ionizing radiation.
(14) The results indicate that thyroid hormones are essential for normal proliferative expansion of olfactory epithelium and for maturation of ORNs postnatally.
(15) Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA.
(16) OCT 1 is highly inhibited by low concentrations of phaseolotoxin and Orn-P(O)(NH2)-NH-SO3H, OCT 2 is insensitive to both compounds.
(17) In mature newborn infants, 7 (Ala, Lys, Leu, Val, Ile, Phe and His) of the 20 plasma amino acids were significantly higher and 4 (Glu, Gly, Ser and Orn) were significantly lower in the umbilical vein than in the umbilical artery.
(18) The effects of an ornithine-containing lipid [alpha-N-(3-acyloxyacyl)-ornithine (Orn-L)] or a serine-containing lipid [alpha-N-(3-acyloxyacyl)-serine (Ser-L)] from Flavobacterium meningosepticum on lethal endotoxemia in mice were examined.
(19) D-Phe-Pro-Val-cyclo-Orn was obtained as a product of the multienzyme by omission of L-leucine from the complete bioassay mixture.
(20) There have been five patients who had soft tissue ulceration (STU) and one patient who had osteoradionecrosis (ORN).